DPCstruct | MC13835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A5HA15 | 222-310 | RTVGNLVGVQPDHVIVASFWGLSETVDAIGRIVVNSKRAFSDQYLQPGFRKGRNRINGPSAVNFSRIRKSLPGGDFDRSANQQETLR… |
| A0A4Q2WS13 | 1-99 | MKTVSDLVGVDIDNYVVTNVRGFRDIVDVIGGVTLDVEKRMYYYDPFDEPDLRKIDLQPGVQKLDGNKALQYVRFRSDALGDVTRTE… |
| A0A7C2LKF3 | 489-572 | None |
| A0A7C6QJ66 | 1-77 | None |
| A0A2K8N5R2 | 250-339 | None |
| A0A6P1MB00 | 2-94 | None |
| A0A1Q7HTL9 | 296-378 | None |
| A0A1Q7HM52 | 166-256 | None |
| A0A536JBC9 | 247-329 | None |
| A0A3A0APK1 | 420-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.