DPCstruct | MC13832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 120 ± 17 aa |
| Standard deviation of domain lengths | 16.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644ZSI4 | 121-277 | IWVGNDNVQMKLSGDSGNTARLWSGIMTPIHQGLAPAKFALNPNLIPVQVCAQSGKLPSDLCQHDQRGSQVITEYFVPGTQPTETCD… |
| A0A645EXV2 | 6-129 | FERPDGLVSVQICTESGKRPSELCALDPRGSTIRSELFVKGTEPSEDSICDIHVIKDVCIESNKLASEYCPPASIQSKVFIQRPESL… |
| A0A1F9TTM5 | 9-115 | None |
| A0A7C4E6E0 | 15-121 | None |
| A0A536DB11 | 608-727 | None |
| A0A3R6SI06 | 81-197 | None |
| A0A7V2WA78 | 248-355 | None |
| A0A838REI7 | 136-256 | None |
| F0H0X2 | 34-173 | None |
| A0A3L7WNH4 | 35-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.