DPCstruct | MC13831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05582 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6YMN8 | 39-118 | VIFAGACQSYFEAIMDAGANFASSPARILIDFLDPLIVAKNVAITDKNRYVTIDDFVDELRDGKKGVNGFGAIGKRNVII |
| A0A4Q2WN92 | 1-85 | MIFAGACQSCYEAILSSGANFASSPKRVLIHAFDPVFVVEKIAYTSIHDPIAIREIISSTITGFDGIGGVETRGKHRLGVPKTEF |
| A0A7C7D1T6 | 96-180 | None |
| A0A7X9AJ75 | 1-70 | None |
| A0A832QEH2 | 182-255 | None |
| A0A1Z5HQS6 | 76-160 | None |
| A0A0B0HIQ9 | 62-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.