DPCstruct | MC1383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 152 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3I1A4 | 163-323 | SSPSVVKQGWAIRPPKGKMYGAKYIKLYTGEILEIFVCGEKNTSEKLGPSRMLEKLKVKYPNRFNLPSENDIRGEVSRLIQSRKRKQ… |
| G5A849 | 1-186 | MIQLVREYTGSEDVLVILEQGWARRPAKGCMYGANYVAFYKADIARLFQQGVANKSDKLGPRRMLESIQEKYPWRFDFPSSSQIRAE… |
| A0A164LHU7 | 85-233 | None |
| A0A7S3PQN3 | 593-730 | None |
| E9GHE2 | 311-453 | None |
| A0A2R5G062 | 963-1122 | None |
| A0A329SVT2 | 1-146 | None |
| A0A225VSQ2 | 1-156 | None |
| G5A863 | 167-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.