DPCstruct | MC13829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 57 ± 2 aa |
| Standard deviation of domain lengths | 2.19 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 47.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07486 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M8DA44 | 109-167 | DGQIWLEPNENASKAVRSALKGWDPTGGCTYYFNPATATSQWIWSRPQAKKIGKHIFCR |
| A0A4Q2WLI4 | 1-60 | MNNQYKRPLTEESIKAAQEAIGGWDPTEGALYFWNPVTAKSKWVWSRPITDQIGRHVFAK |
| A0A2G7LVA2 | 137-195 | None |
| A0A2N6RNZ5 | 347-403 | None |
| A0A4S3PKU8 | 404-456 | None |
| A0A0L6VYB8 | 245-303 | None |
| A0A7X8ILH7 | 1-53 | None |
| W4R0A6 | 462-517 | None |
| A0A098B3F1 | 228-286 | None |
| A0A0L6VY96 | 330-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.