DPCstruct | MC13828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 132 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.80 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0023- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2WJ77 | 1-150 | MNHREVTLPQSWNLSVADNRILSVALGLMLDGSKVAVVTNDIMLRIKSDLIGVDAQEYRNEQVADVDDQYMGWSDLIVPDQIIDQLY… |
| W4U4X8 | 22-141 | LPDGFRLGDNDTRILAVAQSYRLAGHSVVLVTKDLPLRVKASAIGLEAEEYRHELVPSSGWTGMVNLEVPDEMISTLYEEGSVVDSI… |
| A0A7G3D6Y5 | 1-130 | None |
| A0A0F9SZX9 | 93-227 | None |
| A0A7G8FLW5 | 105-229 | None |
| A0A0H3K3Z4 | 420-543 | None |
| A0A3R6LTJ6 | 1-146 | None |
| A0A388NP33 | 74-203 | None |
| A0A0K2QZH8 | 131-259 | None |
| A0A3N5YYL3 | 102-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.