DPCstruct | MC13826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 89 ± 18 aa |
| Standard deviation of domain lengths | 18.07 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 91.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2WIX1 | 1-115 | MDMNKLVNIISDIVQEQMVQRNPDKYMTEAFKNDEAKIPVGVSNRHVHLADRDLIALFGDDAKLTNFKGLSQPGQFASEQLITLVGP… |
| A0A417DB15 | 5-76 | IPIETSARHLHISQKDFEKLFGEGSKPHFIKELSQPGQYLCQERVTVKGPKGTFENMALLGPFRSDTQVEMS |
| A0A3E2T6V9 | 26-90 | None |
| A0A4R7GMT3 | 381-447 | None |
| A0A1H4P154 | 74-186 | None |
| A0A7W0F9P3 | 2-93 | None |
| A0A378BSM4 | 6-76 | None |
| A0A7C5R134 | 33-136 | None |
| A0A7M2B1C4 | 3-74 | None |
| A0A330LQL4 | 483-552 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.