DPCstruct | MC13824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 176 ± 24 aa |
| Standard deviation of domain lengths | 23.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.72 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF18076- PF18072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855HEZ8 | 160-327 | EGKQALIKANNEFGFALSEQEIDYLTQAFTDLGRNPNDIELMMFAQANSEHCRHKIFGSEWTIDGEKQPLSLFQMIKNTYKESPDEV… |
| A0A4Q2WII2 | 9-182 | GAMELQELSQSLGLAMNSEDLVFCQQYFKNTENRNPTITEIKLIDTYWSDHCRHTTFMTEIEEVSFEKSSLNQPIEKAYGEYLASRK… |
| A0A813GTL8 | 130-387 | None |
| A0A2R7VXI7 | 1-155 | None |
| K7GZC5 | 175-344 | None |
| X0Q618 | 146-306 | None |
| A0A177VIQ6 | 78-257 | None |
| A0A2R2MP78 | 183-328 | None |
| A0A087CAL0 | 145-340 | None |
| A0A379AD62 | 13-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.