DPCstruct | MC13822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 72 ± 9 aa |
| Standard deviation of domain lengths | 9.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5LPV4 | 153-216 | NSSGQSSAASLFEQRQKQYLNGRKATKTITSNSGTVIISEGSTITDDVIEIAKENGKLIELVMN |
| A0A644Z1K4 | 1-68 | MAKNEATDESAKKFDDRHRKYLLGKKASRRIETDNGMIIVDQGGEITEEVLQKAKLAGKFVELSMNIQ |
| A0A7X8DTE9 | 108-179 | None |
| A0A7X8FBY0 | 93-160 | None |
| A0A1S9CKK3 | 248-333 | None |
| A0A0G0Z7Z8 | 34-98 | None |
| A0A7X8ERI7 | 442-499 | None |
| C9RCL1 | 181-250 | None |
| A0A831TPY1 | 187-267 | None |
| A0A7C3KEB8 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.