DPCstruct | MC13821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 8.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377A5G2 | 102-207 | SKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAG… |
| A0A4Q2WGE3 | 1-88 | MKVQTLVKNKDQYLTRPDLGRMLSEEDLAKICKECQGSPQVQIIIADGLSSRAIEANLEDILPALKQGLSAYNLQVGTDIFVKYGESP |
| A0A3M2UGR1 | 159-267 | None |
| G2ZNG5 | 81-169 | None |
| A0A661ZHK8 | 99-201 | None |
| A0A6N6X2L2 | 7-102 | None |
| G1V7C8 | 124-229 | None |
| A0A259UUI3 | 71-177 | None |
| A0A7C7RGI4 | 55-151 | None |
| A0A378DKP5 | 184-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.