DPCstruct | MC13819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 175 ± 22 aa |
| Standard deviation of domain lengths | 22.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6G0D8 | 3-151 | KNGKIKVVLGKIIVINPVGEGKYPTITPSSKGMLTINGKEIYETTKVNESDEIEFLSNDKLSKNIKVDISKDKMEAYISFEYKNAVK… |
| A0A4Q2WFV8 | 1-216 | MDICPIYIQDKITYDRISKIYQNGGNEMIDNFDKKSISGSIPLNNPDNESNSKQRSVAWVNGGKVYVQTTSPEDTVTIVPCPEIQLF… |
| A0A480BDT8 | 1-198 | None |
| Q67LW0 | 15-167 | None |
| A0A3A6N170 | 1-149 | None |
| A0A7Y0Q2N9 | 1-203 | None |
| A0A2S8R8G4 | 17-185 | None |
| A0A231V9B0 | 56-220 | None |
| A0A6I5ZQ09 | 1-164 | None |
| A0A1S8N277 | 2-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.