DPCstruct | MC13818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 133 ± 17 aa |
| Standard deviation of domain lengths | 17.03 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1EEI4 | 3-95 | DLDFGFKIAGLAQEYGVDGYTTPQVMAFALELYEAGILTDQDMPGMPSDNEGRFFWLLEKIVRREGIGDVLANGVYWAAQKIGKGAE… |
| A0A4Q2WFA7 | 6-133 | VYPMPDGKVCSPIEYETAWCFGPNLEIDNLDVVAKLNYICNDAGLDTIEMGVALGVLMEAGVIPFGDADAAVAALEEVAKGTPAGRI… |
| A0A653A1N1 | 857-1002 | None |
| A0A7J2KAL2 | 32-195 | None |
| A0A1W2BRB2 | 482-630 | None |
| A0A662JF75 | 168-290 | None |
| A0A1Q9S2V8 | 230-372 | None |
| A0A7C5MPK8 | 18-165 | None |
| A0A3C0L620 | 4-125 | None |
| A0A3N1VQ59 | 296-425 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.