DPCstruct | MC13817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00591 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8KA22 | 2-102 | GVYSPELVLPIAETLRVLGYQRAAVVHSGGMGEVSLHAPTVVAELHNGEIKSYQLTADDFGLTPYHQAQLAGGTPEENRDILTRLLQ… |
| A0A4Q2WF58 | 1-93 | MAPILARVLANLGTKRSFVIHGCGGLDEISLAGEALVFEIRDNNIKETTLDPVNYGLSRAPISALAGGDAKINARIIKNILSGAQDQ… |
| A0A4Y9JPR0 | 4-103 | None |
| A0A1Y2IAC7 | 218-299 | None |
| A0A0N8HZQ8 | 51-131 | None |
| A0A6A6MGH9 | 2-77 | None |
| A0A1Y2IAR5 | 114-193 | None |
| A0A7C1SVG3 | 3-79 | None |
| A0A2X3JFI7 | 1-72 | None |
| A0A1U8HN90 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.