DPCstruct | MC13815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 116 ± 24 aa |
| Standard deviation of domain lengths | 24.13 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06718 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G2FRX7 | 87-212 | TPLQTVAQGQANPCRHCLQLIAPGDAMRVLSYRPFAGLQPYAETGPIFLHAHDCKHYQADRLPDWFAYLDPAVIRGYGHNHWIRYET… |
| A0A7W0XVX0 | 24-143 | DDGGAPLRCCLRDSRTGERIALLAVTPVGPSGAYRETGPVLVHAEACAGPATDDYPVDWRARAQVLRAYDPAGEIAGGEVVPAGADI… |
| A0A2U3DST9 | 7-160 | None |
| A0A0J6F9X1 | 2-74 | None |
| A0A401W8Z7 | 97-241 | None |
| A0A7U2V1M9 | 4-157 | None |
| A0A1C4TIT3 | 107-222 | None |
| A0A0J8YVP8 | 6-94 | None |
| A0A1W7M8C9 | 1-71 | None |
| A0A2G6YM12 | 15-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.