DPCstruct | MC13811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 240 ± 28 aa |
| Standard deviation of domain lengths | 28.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3G4S7 | 1-247 | MTQCQGNATCENAVVDKYKKISAEQHESVVNCKGAQECVDKANEVGKLQTDYANRTNELLEKARVNGGLSPEDQNELSILQVTTIQL… |
| A0A2T2XWW0 | 1-273 | MSERVVVENNHLSQPQQQSRSEEIVACGSDSSCKTDVRKNYAKEYDIVQEKIKNCSSAADCVAVAKEMKEWKAESSARSDELAAKAR… |
| A0A8B3FKG7 | 143-380 | None |
| E3DGW7 | 93-339 | None |
| A0A1B8YJU0 | 170-415 | None |
| A0A6G9RIJ1 | 4-198 | None |
| A0A7C9GRS2 | 54-298 | None |
| A0A6S7DDL2 | 337-618 | None |
| E5BAY3 | 288-553 | None |
| A0A2S8QKN3 | 2-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.