DPCstruct | MC13810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.26 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 74.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E5BAW9 | 69-149 | VSEKTELEIAKQKLQNSKDPAERESAQKKVAELTELDISRDKKVIEACGNGSAGSAACASARLEVIAAKGGYETGQYNNKV |
| E3G4S0 | 1-95 | MSEKTELEIATQILQNSKDPKEREKAQQKYDALREKDITSDKEVIDACGNGNAGSSACAGARLKVIASKCKYPRKQRQAKLAYPVFS… |
| A0A2X5K734 | 1-79 | None |
| A0A4C6ISD8 | 1-83 | None |
| A0A7U9BPH5 | 1-79 | None |
| A0A1B1KX21 | 362-439 | None |
| A0A7W4F4S8 | 267-345 | None |
| A0A0T9V1W4 | 27-105 | None |
| A0A220QJD7 | 81-159 | None |
| A0A1W5DRH9 | 27-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.