DPCstruct | MC13809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 43 ± 3 aa |
| Standard deviation of domain lengths | 2.97 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 61.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9RL59 | 41-83 | NNNKQYFKNCADLRKVYPNGVPKGNKAYQAQMDRDHDNYACET |
| A0A6M8GK69 | 212-250 | EYFANCTDLRKKYPKGVPSTHQAYQKKLDRDNDKYACEN |
| A0A5J6ST55 | 349-391 | None |
| A0A7U1BXQ5 | 20-61 | None |
| Q2G2Y4 | 169-214 | None |
| A0A1E9A3T6 | 323-368 | None |
| A0A844JLX6 | 110-153 | None |
| A0A174RNN7 | 617-660 | None |
| A0A285UCF9 | 410-451 | None |
| A0A2A7WNN8 | 60-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.