DPCstruct | MC13804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 194 ± 21 aa |
| Standard deviation of domain lengths | 21.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447JCG5 | 1-192 | MTANSILEYILVFFGWMLNNAMWDILSSTGLYLLPLAFKGMGIWLKVREEGFDEGNKGMLSLPRLENSIYVSFLVICFCCTPMFPVD… |
| A8AM58 | 2-194 | TTNSYLEYFLTLLGWVVNNGLWNAISATGLFALPLLIKLLALWLQARSQGADEGNKAALALVWTEHLMYTSLLVIMFTCVPMLNIDL… |
| A0A2A2UWB1 | 1-230 | None |
| A0A402XLK2 | 1-195 | None |
| A0A5E6NP22 | 6-229 | None |
| Q7VMP5 | 4-198 | None |
| A0A6H0JMG5 | 194-386 | None |
| G9ZJA9 | 1-189 | None |
| A0A0A0CSB0 | 1-198 | None |
| A0A2D0IP09 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.