DPCstruct | MC13803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 332 ± 45 aa |
| Standard deviation of domain lengths | 44.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.89 |
| Pfam Score | 48.20 |
| Assigned Pfam label(s) | CL0063- PF16420- PF15253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7MTK3 | 6-280 | VSDLKFAPSFQSFVDSSFFHELSRLKLDIFKLDSDEKALYTQLDLNQFTSNVLAISLRDDSFQKPDNDEHNIILKGYLLNFNTIELF… |
| A0A022XS52 | 1-346 | MQYTPFISDIELPFYSSLASLKVDHDKLDDSARKVLGLYEIKPSDRPEESCRMQILGNALLKDDVPAGYYRAEGVIKNVNTIEEYRN… |
| A0A146I083 | 283-633 | None |
| R9PAQ8 | 478-870 | None |
| A0A0D2MR05 | 14-336 | None |
| S4RI50 | 22-374 | None |
| A0A835TRS6 | 5-353 | None |
| A0A0N4TMR8 | 439-771 | None |
| A0A060S7Q8 | 2-338 | None |
| A0A5K1JXE5 | 3-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.