DPCstruct | MC13802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 180 ± 18 aa |
| Standard deviation of domain lengths | 17.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6U170 | 2-162 | KDFFPKPDSPHIRRTSAAWQHPVYTESQMNAITIAHRSARTTSDRVALTLVRILRFGLDLATGYKHDKAVALSKKDPKFANQKYGMS… |
| A0A022XNG0 | 38-213 | GLRGNSASIYSQNSHDQGRNFSITSPARLKEFFAAPKQTKRIVETESAFEHPVFTQKQMKDIIVAHRETKNWSDWVALGTVRLLRWG… |
| D0NET6 | 1-173 | None |
| A0A3M6UKY8 | 4-186 | None |
| A0A6P4BPI3 | 1-160 | None |
| A0A0G2GVL9 | 1-223 | None |
| A0A4Y9Y8V7 | 553-735 | None |
| A0A178EQ55 | 123-282 | None |
| A0A5K1K3P9 | 22-183 | None |
| A0A2G8L250 | 39-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.