DPCstruct | MC13801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 135 ± 14 aa |
| Standard deviation of domain lengths | 14.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A545ULB3 | 125-241 | FNRKDLFTQHLRRMHGSFNRALTKENNDQQQSEWESYIKGMQQNCLVTRRRPPQQSSCPKPGCVNTFDGPTAWDEWATHVGRHMENG… |
| A0A022XKX7 | 1-138 | MRTPNDFNRKDLFTQHLRRMHAPWLTLPSPHEPTKGEREAFDKQLDEVRARCWVQQRQAPQRSQCNYCSHEFVGPHSWEDRMEHVGK… |
| A0A084RW47 | 434-567 | None |
| A0A094G3J0 | 321-456 | None |
| A0A484G9J8 | 1-137 | None |
| A7F1W1 | 1-108 | None |
| A0A6G1GZG6 | 149-308 | None |
| A0A2J6S1E3 | 229-371 | None |
| A0A6A6JXT2 | 393-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.