DPCstruct | MC1380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 7.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H1QNZ9 | 17-121 | SMQQISGQDATFLYAESPTSTMHVATLTIVEGSIEFNDFKEIVASKLHLIPKFRKRLLNVPMNLDYPYWVDDPNFDIDLHINRLKLP… |
| A0A378U8N5 | 2-94 | VNRLSASDAAFFHLENTATPMYVGSLSILRKPRAGLSYETLLETVEHRLPQIPRYRQKVREVTLGLARPVWVDDRDFDITYHIRRSA… |
| A0A2D6BNE6 | 65-177 | None |
| X8FHS5 | 2-110 | None |
| A0A2S8BMM3 | 16-119 | None |
| R4MJ28 | 21-115 | None |
| X8C3H5 | 3-95 | None |
| X8FFX9 | 2-89 | None |
| A0A3D0D8T3 | 4-108 | None |
| A0A3D9UIZ2 | 9-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.