DPCstruct | MC138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2873 |
|---|---|
| Mean domain length (aa) | 224 ± 38 aa |
| Standard deviation of domain lengths | 37.85 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.37 |
| Mean intra-cluster sequence similarity (%) | 11.79 |
| Pfam Score | 75.78 |
| Assigned Pfam label(s) | PF01016- PF20888- CL0329- PF20254- CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8V5J7 | 10-168 | VITKEQDFSSYRLLIVPMLYLASEETIARLKAFSANGGTLVMTYISGIVNEYDLTYLGGWPQDLQELFGIVPVETDTLYPGDKNAVR… |
| A0A842VUT9 | 4-220 | KALCVYGGWKGHTPKKSMKKMIKILQDEGFEIVKKKTLDAYKDRKLMESLDLVVQCWTGGNLEKDQEDGLSYAVMDGVGLVGWHGGL… |
| A0A3A0B6E9 | 589-822 | None |
| A0A257QEB0 | 44-292 | None |
| A0A0N0TPJ9 | 17-231 | None |
| A0A5S6QF88 | 28-234 | None |
| A0A5S6QT58 | 333-579 | None |
| A0A0G1HQQ6 | 67-250 | None |
| H0EHH0 | 1-203 | None |
| U1P7M5 | 8-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.