DPCstruct | MC13799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 154 ± 30 aa |
| Standard deviation of domain lengths | 30.04 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 91.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7X780 | 4-151 | LVKLIHDTAPSKAIKLMEVCGTHTVSIFRHGIKALLPKQISLISGPGCPVCVTSVNDIDAAIALSKMPEVILVTFGDMMHVPGSNRM… |
| A0A150JL13 | 10-176 | SDTLIQKISEISKNLDEIKICHVCGTHEHVITHYGIRALLPDNVQVVSGPGCPVCVTTQGEIEAAVNAAEKGAIVTTYGDMIRVPSR… |
| A0A520K853 | 14-176 | None |
| A0A2G6FLM3 | 61-236 | None |
| A0A451A9P2 | 8-178 | None |
| A0A376TU74 | 4-190 | None |
| A0A357NG42 | 62-240 | None |
| A0A833GXR1 | 2-89 | None |
| A0A7R9N0Z6 | 15-164 | None |
| A0A4U9THL0 | 3-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.