DPCstruct | MC13798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 147 ± 14 aa |
| Standard deviation of domain lengths | 14.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150IWA9 | 1-167 | MTLERKISALFKMDDENWKKHSNPWSVITRNTVTPLLVIAFWSRIWLGWYSIIPIVLSFIWMYTNPRIFSPPKSTDNWASKGVFGER… |
| A0A329T562 | 1-141 | MTVLESIRDAVWRRHANPKSGWSRVLVTPVLLYAVYRRDGRLAVLAVAFTIVNPVLFSPPADDDAWMTRVVLAERWWVEERGEAVLS… |
| A0A517SZP9 | 6-171 | None |
| A0A2T7HIU8 | 2-132 | None |
| A0A2S3UNQ8 | 20-182 | None |
| A0A3D5FVP1 | 1-137 | None |
| A0A849ZE86 | 7-132 | None |
| A0A1H8VEY3 | 48-193 | None |
| A0A4D7HBD3 | 8-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.