DPCstruct | MC13797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18843 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3R388 | 8-90 | EGDYEQLVINETIDGLFSSYRIDRNSLPKGFFLYEIRWDDSLSSLAEICPSVVVNHAGSFITKSPLEFDANNSIRITYANFIE |
| A0A150ITC0 | 42-122 | EEEFRGKTIYIFPMGRVDIKRLPEGYHRYSVRGSDYDWGQAATIEHSVGVNYWGFVLSKEELDLNKVDYGGTKYIQLTKKE |
| A0A6L5X366 | 320-415 | None |
| A0A316NPU0 | 8-101 | None |
| A0A6N9Z608 | 134-220 | None |
| A0A373XYT1 | 187-274 | None |
| R9INC6 | 5-95 | None |
| A0A829Z891 | 132-229 | None |
| A0A1Q6L0U1 | 413-505 | None |
| A0A3E4P9S0 | 8-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.