DPCstruct | MC13796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 60 ± 7 aa |
| Standard deviation of domain lengths | 7.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150IN63 | 14-68 | MQVAKNLCEMCARKDPTENKCEAFPLGIPQEILSMEFIHTKPFPGDHEVIFLSKN |
| A0A382VW55 | 55-102 | CDLCKHIHKDEISCDAFPDVIPSDINNGIIDHRKPFPGDNGIMFEPKE |
| A0A1Y2ZYK8 | 2-57 | None |
| A0A7C1VWJ1 | 1-68 | None |
| A0A381R8K0 | 11-80 | None |
| A0A426TT83 | 2-77 | None |
| A0A6S5J2C7 | 91-148 | None |
| A0A847V429 | 1-59 | None |
| C6XE99 | 3-66 | None |
| A0A355U1B5 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.