DPCstruct | MC13794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 168 ± 18 aa |
| Standard deviation of domain lengths | 18.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9T0Z6 | 216-390 | VHDVYENHCPLNKFIRQVVDFKNNSQNYSNVSYLKDIVDENNEALKNIGCAVYKGYTRLTAYHEEDRKTFCDYLNLWLDEQKSIYVT… |
| A0A0J9T3J5 | 1-175 | MSYVMLLIMFLNYFLLNIDVFLRSSNLNILIRKLNDKKHGNCCVETENFLKSIDGSKKVSLKILGCSLECSYRYVTAFNGNTLTDLC… |
| A0A0J9TK61 | 472-635 | None |
| A0A0J9T2I4 | 31-205 | None |
| A0A1G4EA57 | 4-159 | None |
| A0A0J9U0E3 | 177-370 | None |
| A0A0J9W6B4 | 2-143 | None |
| A0A0J9SVX4 | 606-799 | None |
| A0A0J9SN98 | 2-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.