DPCstruct | MC13792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 94 ± 16 aa |
| Standard deviation of domain lengths | 15.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 50.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P5DIG2 | 91-166 | VDTLKQTILQLAVMGKLVPQDPNDEPASELLKRIAQEKAQLVKEGKIKKQKPLPPISDEEKPFELPEGWEWCRIDD |
| A0A7Z9D755 | 4-110 | QQLKNAILQLAIQGKLVPQDPNDEPASVLLEKIKQEKEKLIAEGKIKKSKKASDTPPYLNESEFPFEIPESWVWVRLGDIFNLQAGK… |
| A0A829DI95 | 5-96 | None |
| A0A449ALZ7 | 12-125 | None |
| A0A378MRA4 | 21-140 | None |
| A0A7C1KYE7 | 126-225 | None |
| A0A1C6GV87 | 152-254 | None |
| A0A8A5FA03 | 1-117 | None |
| V5F387 | 37-124 | None |
| K1XFA5 | 2-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.