DPCstruct | MC13791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 9.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8IYT1 | 274-382 | GNKYPHLMALVSSTLAESASNSVLAMCDNSSAIRGLRVPVLCPVDPARGSELRLLPDPQLRHVILTAETHNFPTAVAPFEGAATGAG… |
| A0A2X2VGB9 | 62-172 | WIIDGKPQPKSLFKMIKNTFETTPDHVLSAYKDNAAVMEGSDVGRYFADHESGRYDFHQEPAHILMKVETHNHPTAISPWPGAATGS… |
| K7GZC5 | 234-346 | None |
| A0A2J7ZPD6 | 1-95 | None |
| A0A803LBM8 | 328-428 | None |
| A0A855HEZ8 | 220-327 | None |
| A0A6I9YU91 | 90-205 | None |
| A0A177VIQ6 | 149-263 | None |
| A0A2R7VXI7 | 48-157 | None |
| X0Q618 | 192-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.