DPCstruct | MC1379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 105 ± 18 aa |
| Standard deviation of domain lengths | 18.40 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.76 |
| Pfam Score | 99.00 |
| Assigned Pfam label(s) | CL0080- PF07929 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378U8C5 | 5-98 | ETVLVDTADTVIVFETALEPRLYVDPALVRTDLLQPSTTTSYCNYKGTATYWSAVLGDTVIADVAWSYPDTPPESLPIQGLLSFDAT… |
| A0A7C8PMU1 | 23-119 | KMSAKAVVNGVVIAETDRYEKVEGNVYFPPDSLKSDYFKTTETHTACPWKGLASYYTIDIGDGNPLVDAAWYYPEPKPAASNITGYV… |
| A0A534S2E5 | 2-94 | None |
| A0A537TDJ4 | 124-235 | None |
| L7ISV0 | 5-75 | None |
| A0A366ZPD7 | 43-144 | None |
| A0A3B0W7Q6 | 26-134 | None |
| A0A317XRR7 | 16-142 | None |
| A0A1V3X0T8 | 2-101 | None |
| A0A559TS31 | 105-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.