DPCstruct | MC13789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 107 ± 18 aa |
| Standard deviation of domain lengths | 18.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.68 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | CL0123- PF01776 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3XE72 | 2-79 | LQERIKVGGKAGALGDTVTVTRDKTKITVTSDSTFSKRYLKYLTKKYLKKNNVRDWLRVISSNKDRNVYELRYFNIAE |
| A0A2K6V0B9 | 1-95 | VAPRKDKEPKKSNWKFNLDLSHPFLQEKVKVNGKTGNLRNVVHNEPFENNITVVSEKQFSKRYLKYLTKKYLKKNSLCDWLRVVELC… |
| A0A287X281 | 14-104 | None |
| A0A816Q1S7 | 838-960 | None |
| A0A4Y1QZW5 | 139-254 | None |
| K4AEP2 | 95-229 | None |
| A0A7R9T4C0 | 165-274 | None |
| A0A842XV93 | 2-92 | None |
| A0A077ZYM8 | 817-932 | None |
| A0A811ZN08 | 4-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.