DPCstruct | MC13787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Standard deviation of domain lengths | 10.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3ND85 | 144-247 | FCVWQTKTDKKWQKGCISASKIELDEDVSDLEDGSDFFLRDFDGNPVTVKNTLGQFIEKDLDMETIEKVVNGEAITKEFVQKLNPEY… |
| A4X7B8 | 20-116 | VCLWRRHDEEQWHAGEIDFPDGDDPDGASRLFKVLVEGAPAAYHRFAEDYYETAIDLEAVGEIFALRPLTNELVRRLNADRVVTDLA… |
| A0A328NT65 | 396-515 | None |
| A0A2G4DJ80 | 8-112 | None |
| A0A661P5T9 | 110-221 | None |
| A0A0A1SR81 | 124-214 | None |
| A0A2Z4IT77 | 1-89 | None |
| A0A6I1YY99 | 219-320 | None |
| A0A5S4EVT9 | 11-117 | None |
| A0A1P8Y9Q0 | 41-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.