DPCstruct | MC13785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0431 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A195DFH2 | 1-70 | MATDQGSKLGLGKNKTIICMYSNYQVIQINKLPLVISFIASHSCNTGHVLSLENKIDPILSSLKNAVVEA |
| A0A0N0BF69 | 2-80 | RASFLSTFGMATDQGSKLGLGKNKTIICMYSSYQVVQMNKLPLVISFIASHNCNTGHILSLESKIDPILSNLKNAVVEA |
| A0A7S1J3K8 | 22-108 | None |
| A0A7E4RFJ6 | 10-85 | None |
| A0A3P8P106 | 55-133 | None |
| G3IIX9 | 169-248 | None |
| A0A397V651 | 7-73 | None |
| A0A7R9CSA7 | 319-397 | None |
| A0A183JKC4 | 1-86 | None |
| A0A1D2MA70 | 107-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.