DPCstruct | MC13783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 388 ± 63 aa |
| Standard deviation of domain lengths | 62.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.55 |
| Pfam Score | 81.82 |
| Assigned Pfam label(s) | CL0023- PF20173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177UGP2 | 1-451 | MLSTLAEVDATSRELDARTITLACGHVFTVETLDGHFQMSAFYTKGPDGEWQRNPSLPTDFFTAFSCPACRSPTSAMRYGRPKKRAC… |
| A0A559L8E1 | 34-440 | VCVDFLEMKEYKEIDLDQEPCIFPDCGHFLTVSSMDGQMDMAEHYKLDTTGLPEQILRSSEPFAMENKDVKNCATCRGPLRNISRYG… |
| A0A8A3NXW6 | 129-536 | None |
| W9VW94 | 2-325 | None |
| A0A842YSB9 | 1-317 | None |
| A0A835XVU1 | 5-392 | None |
| A0A420N1R6 | 229-636 | None |
| A0A5K1JY96 | 390-822 | None |
| A0A433DMP6 | 1-509 | None |
| U7PIR7 | 1060-1541 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.