DPCstruct | MC13782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 188 ± 19 aa |
| Standard deviation of domain lengths | 19.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.73 |
| Pfam Score | 86.93 |
| Assigned Pfam label(s) | PF01915- CL0301 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M9YN32 | 875-1098 | MLGQFKPGLKVPGSRLTITTKLTPSTSGDHTLTIRCTGAFTLTVNGETVLTGSDKGIPTEQFIFNHILLETGTQISMEAGVCYDIRL… |
| A0A2V1BM64 | 434-619 | DAKEVFYISMSMYFTPQESGRYEFGLAVDGTANLYINDQLIIENTTSQRSGSLFFGRGTAEEKATWEMEAKVCYLLRVECGSAATST… |
| A0A842YUB9 | 159-344 | None |
| A0A1M6TY42 | 749-960 | None |
| A0A838UYR8 | 226-420 | None |
| R1EFS2 | 312-516 | None |
| H1W5M8 | 201-392 | None |
| A0A2V1BLI3 | 87-265 | None |
| A0A812UWB0 | 683-849 | None |
| A0A2A3HQY0 | 329-542 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.