DPCstruct | MC1378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 174 |
|---|---|
| Mean domain length (aa) | 101 ± 21 aa |
| Standard deviation of domain lengths | 21.25 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.17 |
| Pfam Score | 94.64 |
| Assigned Pfam label(s) | CL0123- PF08706- PF18326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9DHD5 | 2-74 | WFVEEHCELIPEQFEYSRQLYQYYKQMCLENGLQPISQTKFNKSLQNDYPKQLLRTEESNSKRIIFKGIKIRR |
| A8SI46 | 9-88 | EDMDILGPYINENCIINPMAKVESRKLYDDYKKWCYQNDELELKNRSFYRQLVTRGFKKKRGTANKIFFYGIGLKKEQSY |
| A0A2A4JU32 | 1-112 | None |
| W9AIZ4 | 65-159 | None |
| Q6FS37 | 368-457 | None |
| Q6FXL2 | 152-279 | None |
| A0A1V5FMB1 | 661-744 | None |
| A0A1D2N8M7 | 608-740 | None |
| A0A021X456 | 166-250 | None |
| A0A1P8WR89 | 1169-1249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.