DPCstruct | MC13778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 151 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF10067- PF20327- PF07301 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5VV54 | 131-265 | FAMMARTYSKPWKLMTVTCLLPAFAASSSYAIQLWLFSERMPQLQWIGIAATVGLIVGLIRARTHEIYYENGQIMARRTAAYLIIWA… |
| A0A5P9Q686 | 32-186 | DAAATANHAALVVVLVVVAWLIVRQLTARRLDPRSTLAWVLLAVGAAETLAYLTGAHVTARDVALLVVSAAVGGALAVVRARTMRLW… |
| K0F8X8 | 4-156 | None |
| Q97G64 | 2-151 | None |
| A0A7I8EYW7 | 2-129 | None |
| A0A846J7X2 | 10-159 | None |
| A0A7G9SE11 | 7-171 | None |
| A0A7R7CRA8 | 166-321 | None |
| A0A355EM59 | 5-169 | None |
| A0A1C5ALR7 | 3-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.