DPCstruct | MC13777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 3.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3LQH9 | 1-60 | NLTRAAATVAGGSLMRATTTTIRRALIGVPARISSSARRLSLHLPVGWPWEIEWNRLYAS |
| A0A1B6AVQ6 | 1-71 | MAHNLGRAVGILASHDLARATAATLQRTLFTVPGRLVHTARRLHLRLPTHWPWADAFTHALTAVTALPQHG |
| C1B4Y2 | 87-154 | None |
| A0A098BS67 | 208-271 | None |
| A0A2A3F601 | 238-299 | None |
| A0A2W6DYX7 | 100-166 | None |
| A0A6P1ICH1 | 373-431 | None |
| A0A6P1IAF1 | 289-355 | None |
| A0A350IQT9 | 66-134 | None |
| A0A2U9PT84 | 136-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.