DPCstruct | MC13772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 151 ± 20 aa |
| Standard deviation of domain lengths | 19.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.06 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF14784- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K3EQP4 | 44-184 | MKEYEVADDLEAYKALLTVPPRMGRLKAKSFLHADMGAYKRQQDTISKLLMQLNASQVMPDDDVGDAIVEIFGFRSHVMTHYRRMMY… |
| A0A3S1BRD8 | 204-333 | MDHFGVHKDLDAYKALIQAFPEEKMIPRNAWQVEFMHYPRHQQCGIDLLEQMEHNGVIPDDAFGVLLKNRFGREAHVTRKFRRMLYW… |
| A0A2A6CPN8 | 46-185 | None |
| A0A2P2I4Q4 | 7-151 | None |
| A9V8X9 | 86-238 | None |
| T2M6R8 | 127-265 | None |
| A0A834PBM1 | 69-208 | None |
| A0A1S8X8J1 | 1-147 | None |
| A0A6P8ZW98 | 124-263 | None |
| A0A2H1C4K7 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.