DPCstruct | MC13771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Standard deviation of domain lengths | 10.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 84.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445BLA8 | 51-134 | VAIGLHFYPIAASVDEWLYNGGPYELIVLHFLLGVSCYIGCKWELSFCLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGM |
| A0A481ZRC5 | 91-193 | LHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGIS… |
| A0A2U1N7P5 | 64-155 | None |
| A0A3B6KD74 | 55-132 | None |
| A0A0X8WQU2 | 114-191 | None |
| Q7XCI7 | 90-185 | None |
| A0A2G3D3A0 | 321-404 | None |
| B9RRG9 | 55-157 | None |
| M7ZDW4 | 171-273 | None |
| A0A2G2ZRF4 | 91-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.