DPCstruct | MC1377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 170 ± 38 aa |
| Standard deviation of domain lengths | 37.67 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13503 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A560Z4Y1 | 2-169 | NTWILLERPAAQLETLYRLATHPDTQKLFAGTSLAGFAEQSPLLVRLDNQPTLTLAIEQTPAQWSGLLIESASDTPSLLAHLRQMLF… |
| A0A3N9TM51 | 6-156 | IKQYYLVLDRIRAEDAPKVCAQAGIEYQALYLGTAWQPQMDNSPIWIKISPEDAVWKKWSNDPLWASSGILFEFDETADEQNILASL… |
| A0A558BGT3 | 13-197 | None |
| A0A3A5FGL2 | 111-289 | None |
| A0A357NJ40 | 5-100 | None |
| A0A447L6W3 | 187-357 | None |
| A0A853JJP0 | 145-321 | None |
| A0A6P2H7S8 | 18-196 | None |
| A0A1C2HEA0 | 54-226 | None |
| A0A2S0P574 | 3-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.