DPCstruct | MC13766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 254 ± 22 aa |
| Standard deviation of domain lengths | 22.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2E7R3 | 2-190 | IPGIQDLDNVQTVAGMTILYSVAKKAAEYETHLEVPTARSLVMTTARETVKEAYLSTGRPDLYSENSIYYVTDEQFGYVAYADGYIV… |
| A0A0M0BD01 | 3-228 | LENILIILGMAAPMVLFSYLSGTGRVRFELRRLPMLDFVEDMIRAASERAQQLMFVVLRHICSVAARLNVRTIVTSAQPEIASVIAD… |
| A0A1Y1RED0 | 101-359 | None |
| A0A1W9ISG6 | 131-386 | None |
| A0A7V5ARX8 | 637-890 | None |
| A0A7V9AR08 | 66-339 | None |
| A0A832FX63 | 231-485 | None |
| A0A4Q3W3C9 | 10-253 | None |
| A0A4Q3V466 | 14-301 | None |
| A0A3D2RZ05 | 393-642 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.