DPCstruct | MC13765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 181 ± 8 aa |
| Standard deviation of domain lengths | 8.07 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 78.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8RQD5 | 290-474 | HSRVYTSDATNALVEAVRSAPANEATCHLVDVTSLPDVFRIVADEKQALVVRLPDSWLEDLDALAHYDGLEPFFRKDTSNGQCLSSL… |
| A0A4R8K0N2 | 1-186 | MQTTQVKQKELSANDLDQKLMSFISKYVAAVEHPSSFYVLAEDALTNEDLQQDEYCIIVTLPRHKASDFRATKADYGACVITSPNDS… |
| A0A2C8ZXQ0 | 9-196 | None |
| A0A3E0CAW2 | 79-248 | None |
| A0A160FTI4 | 325-507 | None |
| I5D078 | 5-174 | None |
| A0A5C6V0D7 | 216-388 | None |
| A0A5C6V2N9 | 67-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.