DPCstruct | MC13764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Standard deviation of domain lengths | 13.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U3YKS7 | 5-115 | IKIIKIGHCPSLSGKTSLTYHVGRREEVIYLQLHGNSNGGFFCKEWVTLERLGVEDNKPISSDLLQAIFKGKSANTGGFLLAALLNE… |
| A0A2N0CXB6 | 1-117 | MITGEAEKINPHSTGLLHWEMTENLDGERGLRITTNDSGGLFSREWIALDAISGVLKAHETGDFTSTALRPLFTSASRNNAGFLAAI… |
| A0A2G2LLG0 | 8-141 | None |
| A0A6N0ZBM4 | 54-198 | None |
| A0A857THX8 | 4-123 | None |
| A0A2A4VL64 | 3-121 | None |
| A0A370DC41 | 9-142 | None |
| A0A6P1E111 | 123-244 | None |
| A0A1I3LNN8 | 1-105 | None |
| A0A4R6QSC1 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.