DPCstruct | MC13759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 101 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Standard deviation of domain lengths | 9.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3SAA7 | 6-76 | SYRTAPFDARFPNQNQTRNCWQNYLDYHRCQKALTAKGADITPCDWYMRVYKSICPGSWVSKWDDQRAEGN |
| A0A7J7B499 | 317-399 | TMPTAVDANDVVLQTAPFDPRFPNTNQTRYCYTSFLDYHRCQKAKGTDYAPCDYFKKVYTSMCPNEWVDKWNNQLEEGTFNGK |
| A0A667IJ19 | 12-77 | None |
| A0A517LDF7 | 31-110 | None |
| A0A5F7ZIF5 | 8-71 | None |
| A0A139WLP1 | 241-327 | None |
| A0A6V2AAL1 | 15-98 | None |
| A0A2P6NYG5 | 3-82 | None |
| C1BSC4 | 69-145 | None |
| A0A7M7GY05 | 43-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.