DPCstruct | MC13758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 4.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 56.93 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | PF16898- CL0413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1BXE3 | 114-176 | YGKIMIMTDQDQDGSHIKGLIINFVHSNWPNLLRHNIVEEFITPIVKVFKGSRELPFYSLPEF |
| A0A7J7ALT6 | 1-65 | MKSLCYRKVMIMVDQQQDESHIKRLLLNFIHHNWPELLHQNFLEEFVSPIVKAIKKRQILTFYSI |
| A0A817YKS2 | 86-149 | None |
| A0A817BR26 | 53-125 | None |
| A0A453PC30 | 7-71 | None |
| A0A0R3Q3X3 | 316-378 | None |
| A0A7R9PU81 | 7-71 | None |
| A0A821TBH6 | 40-90 | None |
| A0A0D3CLU5 | 10-76 | None |
| A0A821TNA0 | 87-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.