DPCstruct | MC13755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 113 ± 15 aa |
| Standard deviation of domain lengths | 14.61 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 16.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661HV53 | 2-112 | TVVFNKSDAIEPFSFRFIDDDGAVILKSENYKAKNSALNGIESVKKNAVSEKRYDLKTAKNGKFYFNLKSTNGQIVGTSTMFANEVD… |
| A0A3D8L7F0 | 43-161 | MKWFNFYQDKSLQWRWRLKDGNGAVVADSGEGYNDRKDCEKGAALFTTLGPNAPERKVSGTEESGNGPEWEYFEDRADEWRWRFQAK… |
| A0A7K2C9S9 | 4-128 | None |
| A0A7S9LNT5 | 6-98 | None |
| A0A2D7XV88 | 38-146 | None |
| A0A4R7XSL5 | 2-108 | None |
| A0A1T5CX26 | 41-144 | None |
| A0A561IK90 | 2-99 | None |
| A0A661PCY1 | 16-124 | None |
| A0A2V2EUC1 | 93-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.