DPCstruct | MC13754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 135 ± 9 aa |
| Standard deviation of domain lengths | 9.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U6GLB4 | 5-139 | IIRPQEIYLLERYSSPAYFKEMRDAFANMLEAAEYALELFVNDLPFDYRTRPINRQPDIVWGERVLPNLRDTLDSLNVGYQELLKGD… |
| I2URU0 | 21-162 | ILHPQECWLLERIMSPEYYRRRFEGWQEFVELCERQVAEWSKTMPLDVRRRPLCEQIDVVWGGRVLPNIRSTLKSVQYDFIQLQQGD… |
| A0A377KDM1 | 1-121 | None |
| A0A2V4UQF7 | 5-139 | None |
| A0A4R6DWG6 | 3-141 | None |
| N9K317 | 8-153 | None |
| A0A077L0F9 | 143-278 | None |
| A4WCZ5 | 462-574 | None |
| N9M9L0 | 8-146 | None |
| A0A0A0EWQ1 | 4-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.