DPCstruct | MC13753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K4H7X5 | 45-108 | LCEPETGVFMKNALSSDVCSLYEKEALVQLVKTASPHPLSRENIDVSMIVSRESCYFDNQSGNF |
| I2UG56 | 1-60 | MKNSDGSDVCTLFDAAAFSRLVGEGLPHPLTREPITASIIVKHEECIYDDTRGNFVIKGN |
| A0A6C7D084 | 1-79 | None |
| A0A0H0NYE8 | 70-135 | None |
| A0A376UBE8 | 5-69 | None |
| A0A3J0XUR1 | 103-164 | None |
| A0A248KAV6 | 51-118 | None |
| A0A822UCG3 | 85-150 | None |
| A0A786TQ44 | 38-103 | None |
| A0A3Z6PGF6 | 1-49 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.